MIA40 (CHCHD4) (NM_001098502) Human Mass Spec Standard

SKU
PH317831
CHCHD4 MS Standard C13 and N15-labeled recombinant protein (NP_001091972)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217831]
Predicted MW 15.8 kDa
Protein Sequence
Protein Sequence
>RC217831 representing NM_001098502
Red=Cloning site Green=Tags(s)

MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS
AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG
SS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001091972
RefSeq Size 1476
RefSeq ORF 426
Synonyms MIA40; TIMM40
Locus ID 131474
UniProt ID Q8N4Q1
Cytogenetics 3p25.1
Summary CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:MIA40 (CHCHD4) (NM_001098502) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420602 CHCHD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420602 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP317831 Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 4 (CHCHD4), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.