SDS (NM_006843) Human Mass Spec Standard

SKU
PH317814
SDS MS Standard C13 and N15-labeled recombinant protein (NP_006834)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217814]
Predicted MW 34.4 kDa
Protein Sequence
Protein Sequence
>RC217814 representing NM_006843
Red=Cloning site Green=Tags(s)

MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM
AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL
IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL
VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH
VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006834
RefSeq Size 1620
RefSeq ORF 984
Synonyms SDH
Locus ID 10993
UniProt ID P20132
Cytogenetics 12q24.13
Summary This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq, Jul 2008]
Protein Pathways Cysteine and methionine metabolism, Glycine, Metabolic pathways, serine and threonine metabolism
Write Your Own Review
You're reviewing:SDS (NM_006843) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416388 SDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416388 Transient overexpression lysate of serine dehydratase (SDS) 100 ug
$436.00
TP317814 Recombinant protein of human serine dehydratase (SDS), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.