REPS2 (NM_004726) Human Mass Spec Standard

SKU
PH317778
REPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004717)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217778]
Predicted MW 71.4 kDa
Protein Sequence
Protein Sequence
>RC217778 representing NM_004726
Red=Cloning site Green=Tags(s)

MEAAAAAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAARVAPGTATA
AAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQSGLPVRIESIKCELPLPRFM
MSKNDGEIRFGNPAELHGTKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPLSH
GYSKLRSSAEQMHPAPYEARQPLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITE
EQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVAR
KNGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPNQDV
TSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPPPRPQKTHSR
ASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSRAPSQAAESSPAKKDVLYSQ
PPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLN
SELQQQLKEVHQERIALENQLEQLRPVTVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004717
RefSeq Size 7964
RefSeq ORF 1980
Synonyms POB1
Locus ID 9185
UniProt ID Q8NFH8
Cytogenetics Xp22.2
Summary The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:REPS2 (NM_004726) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317830 REPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001074444) 10 ug
$3,255.00
LC417796 REPS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421142 REPS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417796 Transient overexpression lysate of RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 1 100 ug
$665.00
LY421142 Transient overexpression lysate of RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 2 100 ug
$665.00
TP317778 Recombinant protein of human RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317830 Recombinant protein of human RALBP1 associated Eps domain containing 2 (REPS2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.