MST3 (STK24) (NM_003576) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217776] |
Predicted MW | 49.1 kDa |
Protein Sequence |
Protein Sequence
>RC217776 representing NM_003576
Red=Cloning site Green=Tags(s) MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDS KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD TMVAQLVQRLQRYSLSGGGTSSH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003567 |
RefSeq Size | 4539 |
RefSeq ORF | 1329 |
Synonyms | HEL-S-95; MST3; MST3B; STE20; STK3 |
Locus ID | 8428 |
UniProt ID | Q9Y6E0 |
Cytogenetics | 13q32.2 |
Summary | This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC418583 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422305 | STK24 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418583 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1 | 100 ug |
$665.00
|
|
LY422305 | Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 2 | 100 ug |
$436.00
|
|
TP317776 | Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.