MST3 (STK24) (NM_003576) Human Mass Spec Standard

SKU
PH317776
STK24 MS Standard C13 and N15-labeled recombinant protein (NP_003567)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217776]
Predicted MW 49.1 kDa
Protein Sequence
Protein Sequence
>RC217776 representing NM_003576
Red=Cloning site Green=Tags(s)

MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE
EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI
LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQLAYDS
KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL
LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE
NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD
TMVAQLVQRLQRYSLSGGGTSSH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003567
RefSeq Size 4539
RefSeq ORF 1329
Synonyms HEL-S-95; MST3; MST3B; STE20; STK3
Locus ID 8428
UniProt ID Q9Y6E0
Cytogenetics 13q32.2
Summary This gene encodes a serine/threonine protein kinase that functions upstream of mitogen-activated protein kinase (MAPK) signaling. The encoded protein is cleaved into two chains by caspases; the N-terminal fragment (MST3/N) translocates to the nucleus and promotes programmed cells death. There is a pseudogene for this gene on chromosome X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:MST3 (STK24) (NM_003576) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418583 STK24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422305 STK24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418583 Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1 100 ug
$665.00
LY422305 Transient overexpression lysate of serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 2 100 ug
$436.00
TP317776 Recombinant protein of human serine/threonine kinase 24 (STE20 homolog, yeast) (STK24), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.