ARMCX3 (NM_177947) Human Mass Spec Standard

SKU
PH317732
ARMCX3 MS Standard C13 and N15-labeled recombinant protein (NP_808816)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217732]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC217732 protein sequence
Red=Cloning site Green=Tags(s)

MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES
KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE
AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD
TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL
LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI
ESHHDFLVKVKVGKFMAKLAEHMFPKSQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_808816
RefSeq Size 3367
RefSeq ORF 1137
Synonyms ALEX3; dJ545K15.2; GASP6
Locus ID 51566
UniProt ID Q9UH62
Cytogenetics Xq22.1
Summary This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ARMCX3 (NM_177947) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406053 ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406054 ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413862 ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429505 ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406053 Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2 100 ug
$436.00
LY406054 Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 3 100 ug
$436.00
LY413862 Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 1 100 ug
$436.00
TP317732 Recombinant protein of human armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.