OST beta (SLC51B) (NM_178859) Human Mass Spec Standard

SKU PH317638

OSTBETA MS Standard C13 and N15-labeled recombinant protein (NP_849190)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC217638]
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC217638 protein sequence; Red=Cloning site Green=Tags(s); ; MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP; EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_849190
• RefSeq Size: 940
• RefSeq ORF: 384
• Synonyms: OSTB; OSTBETA
• Locus ID: 123264
• UniProt ID: Q86UW2
• Cytogenetics: 15q22.31
• Summary: Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane