FAHD1 (NM_031208) Human Mass Spec Standard

SKU
PH317597
FAHD1 MS Standard C13 and N15-labeled recombinant protein (NP_112485)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217597]
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC217597 representing NM_031208
Red=Cloning site Green=Tags(s)

MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHH
ELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKI
PDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIH
GLVSMTFKVEKPEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112485
RefSeq Size 1706
RefSeq ORF 672
Synonyms C16orf36; YISKL
Locus ID 81889
UniProt ID Q6P587
Cytogenetics 16p13.3
Summary Probable mitochondrial acylpyruvase which is able to hydrolyze acetylpyruvate and fumarylpyruvate in vitro (PubMed:15551868, PubMed:21878618). Also has oxaloacetate decarboxylase activity (PubMed:25575590).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FAHD1 (NM_031208) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410588 FAHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422654 FAHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410588 Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY422654 Transient overexpression lysate of fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP317597 Recombinant protein of human fumarylacetoacetate hydrolase domain containing 1 (FAHD1), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.