KLC4 (NM_201522) Human Mass Spec Standard

SKU
PH317567
KLC4 MS Standard C13 and N15-labeled recombinant protein (NP_958930)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217567]
Predicted MW 68.6 kDa
Protein Sequence
Protein Sequence
>RC217567 protein sequence
Red=Cloning site Green=Tags(s)

MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHEEGLVHEKARQ
LRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQL
EEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSLDDLFPNEEEEDPSNGLSRGQGATAAQQGGYEIPAR
LRTLHNLVIQYAAQGRYEVAVPLCKQALEDLERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDAL
SIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQ
GKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD
HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECA
LRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVEWSGDGSGTLQRSGSLGKIRD
VLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPSAAPLQVSRGLSASTMDLSSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958930
RefSeq Size 2820
RefSeq ORF 1857
Synonyms bA387M24.3; KNSL8
Locus ID 89953
UniProt ID Q9NSK0
Cytogenetics 6p21.1
Summary Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:KLC4 (NM_201522) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310268 KLC4 MS Standard C13 and N15-labeled recombinant protein (NP_958929) 10 ug
$3,255.00
LC404434 KLC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404435 KLC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404434 Transient overexpression lysate of kinesin light chain 4 (KLC4), transcript variant 1 100 ug
$436.00
LY404435 Transient overexpression lysate of kinesin light chain 4 (KLC4), transcript variant 2 100 ug
$665.00
TP310268 Recombinant protein of human kinesin light chain 4 (KLC4), transcript variant 1, 20 µg 20 ug
$737.00
TP317567 Recombinant protein of human kinesin light chain 4 (KLC4), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.