GLIPR2 (NM_022343) Human Mass Spec Standard

SKU
PH317501
GLIPR2 MS Standard C13 and N15-labeled recombinant protein (NP_071738)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217501]
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC217501 representing NM_022343
Red=Cloning site Green=Tags(s)

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV
NEGFFEENVLPPKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071738
RefSeq Size 1900
RefSeq ORF 462
Synonyms C9orf19; GAPR-1; GAPR1
Locus ID 152007
UniProt ID Q9H4G4
Cytogenetics 9p13.3
Write Your Own Review
You're reviewing:GLIPR2 (NM_022343) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411714 GLIPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411714 Transient overexpression lysate of GLI pathogenesis-related 2 (GLIPR2) 100 ug
$436.00
TP317501 Recombinant protein of human GLI pathogenesis-related 2 (GLIPR2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.