OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GLIPR2 (NM_022343) Human Mass Spec Standard

Be the first to review this product
SKU
PH317501
GLIPR2 MS Standard C13 and N15-labeled recombinant protein (NP_071738)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411714 Transient overexpression lysate of GLI pathogenesis-related 2 (GLIPR2) (as WB positive control) 100 ug
$436.00

Other products for "GLIPR2 or NM_022343"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217501
Predicted MW 17 kDa
Protein Sequence
Protein Sequence
>RC217501 representing NM_022343
Red=Cloning site Green=Tags(s)

MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWA
SYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVV
NEGFFEENVLPPKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071738
RefSeq Size 1900
RefSeq ORF 462
Synonyms C9orf19; GAPR-1; GAPR1
Locus ID 152007
UniProt ID Q9H4G4
Cytogenetics 9p13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GLIPR2" proteins (3)
SKU Description Size Price
LC411714 Lyophilized GLIPR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411714 Transient overexpression lysate of GLI pathogenesis-related 2 (GLIPR2) (as WB positive control) 100 ug
$436.00
TP317501 Recombinant protein of human GLI pathogenesis-related 2 (GLIPR2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products