FGF2 (NM_002006) Human Mass Spec Standard

SKU
PH317426
FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217426]
Predicted MW 30.6 kDa
Protein Sequence
Protein Sequence
>RC217426 representing NM_002006
Red=Cloning site Green=Tags(s)

MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT
EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT
TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL
FLPMSAKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001997
RefSeq Size 6803
RefSeq ORF 864
Synonyms BFGF; FGF-2; FGFB; HBGF-2
Locus ID 2247
UniProt ID P09038
Cytogenetics 4q28.1
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:FGF2 (NM_002006) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400733 FGF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400733 Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2) 100 ug
$436.00
TP317426 Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723719 Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2) 10 ug
$235.00
TP750002 Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli 100 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.