Salivary alpha amylase (AMY1A) (NM_004038) Human Mass Spec Standard

SKU
PH317403
AMY1A MS Standard C13 and N15-labeled recombinant protein (NP_004029)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217403]
Predicted MW 57.8 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC217403
Blue=ORF Red=Cloning site Green=Tag(s)

MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNP
FRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGS
RDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVA
GFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAK
LGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLA
HPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRN
VVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIY
VSDDGKAHFSISNSAEDPFIAIHAESKL

myc-FLAG tag

Recombinant protein using RC217403 also available, TP317403
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004029
RefSeq Size 1862
RefSeq ORF 1533
Synonyms AMY1
Locus ID 276
UniProt ID P04745
Cytogenetics 1p21.1
Summary Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Protein Families ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Metabolic pathways, Starch and sucrose metabolism
Write Your Own Review
You're reviewing:Salivary alpha amylase (AMY1A) (NM_004038) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418295 AMY1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423398 AMY1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418295 Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 1 100 ug
$436.00
LY423398 Transient overexpression lysate of amylase, alpha 1A (salivary) (AMY1A), transcript variant 2 100 ug
$436.00
TP317403 Recombinant protein of human amylase, alpha 1A (salivary) (AMY1A), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.