OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CBLN3 (NM_001039771) Human Mass Spec Standard

Be the first to review this product
SKU
PH317397
CBLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001034860)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367946 CBLN3 rabbit polyclonal antibody
100 ul
$310.00
LY421824 Transient overexpression lysate of cerebellin 3 precursor (CBLN3) (as WB positive control) 100 ug
$436.00

Other products for "CBLN3 or NM_001039771"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217397
Predicted MW 21.3 kDa
Protein Sequence
Protein Sequence
>RC217397 representing NM_001039771
Red=Cloning site Green=Tags(s)

MLGAKPHWLPGPLHSPGLPLVLVLLALGAGWAQEGSEPVLLEGECLVVCEPGRAAAGGPGGAALGEAPPG
RVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGGGFDRASGSFVAPVRGVYSFRFHVVKVYNRQTVQ
VSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034860
RefSeq Size 2340
RefSeq ORF 615
Synonyms PRO1486
Locus ID 643866
UniProt ID Q6UW01
Cytogenetics 14q12
Summary Members of the precerebellin family, such as CBLN3, contain a cerebellin motif (see CBLN1; MIM 600432) and a C-terminal C1q signature domain (see MIM 120550) that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix (Pang et al., 2000 PubMed 10964938).supplied by OMIM, Aug 2009
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CBLN3" proteins (3)
SKU Description Size Price
LC421824 Lyophilized CBLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421824 Transient overexpression lysate of cerebellin 3 precursor (CBLN3) (as WB positive control) 100 ug
$436.00
TP317397 Recombinant protein of human cerebellin 3 precursor (CBLN3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products