FAM36A (COX20) (NM_198076) Human Mass Spec Standard

SKU PH317381

FAM36A MS Standard C13 and N15-labeled recombinant protein (NP_932342)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC217381]
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC217381 protein sequence; Red=Cloning site Green=Tags(s); ; MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVT; LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_932342
• RefSeq Size: 2632
• RefSeq ORF: 354
• Synonyms: FAM36A; MC4DN11
• Locus ID: 116228
• UniProt ID: Q5RI15
• Cytogenetics: 1q44
• Summary: This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]