RUFY1 (NM_025158) Human Mass Spec Standard

SKU
PH317181
RUFY1 MS Standard C13 and N15-labeled recombinant protein (NP_079434)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217181]
Predicted MW 79.6 kDa
Protein Sequence
Protein Sequence
>RC217181 representing NM_025158
Red=Cloning site Green=Tags(s)

MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGWSAPILTLA
RRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMMKLSIKVLLQSALSLGRSLDA
DHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAW
LYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVI
DFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRI
CSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQKNEAITSFEGK
TNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQA
LQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEV
NQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLL
QRCSSTAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079434
RefSeq Size 2644
RefSeq ORF 2124
Synonyms RABIP4; ZFYVE12
Locus ID 80230
UniProt ID Q96T51
Cytogenetics 5q35.3
Summary This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RUFY1 (NM_025158) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307465 RUFY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035541) 10 ug
$3,255.00
LC410873 RUFY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421767 RUFY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410873 Transient overexpression lysate of RUN and FYVE domain containing 1 (RUFY1), transcript variant 1 100 ug
$665.00
LY421767 Transient overexpression lysate of RUN and FYVE domain containing 1 (RUFY1), transcript variant 2 100 ug
$436.00
TP307465 Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317181 Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.