OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MFGE8 (NM_005928) Human Mass Spec Standard

Be the first to review this product
SKU
PH317163
MFGE8 MS Standard C13 and N15-labeled recombinant protein (NP_005919)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA809279 MFGE8 mouse monoclonal antibody,clone OTI7A4 100 ul
$447.00
LY401796 Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MFGE8 or NM_005928"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217163
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC217163 representing NM_005928
Red=Cloning site Green=Tags(s)

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC
VEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG
VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT
SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA
GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN
HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005919
RefSeq Size 1934
RefSeq ORF 1161
Synonyms BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8; MFGM; OAcGD3S; SED1; SPAG10
Locus ID 4240
UniProt ID Q08431
Cytogenetics 15q26.1
Summary This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MFGE8" proteins (5)
SKU Description Size Price
LC401796 Lyophilized MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426493 Lyophilized MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401796 Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426493 Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317163 Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products