MFGE8 (NM_005928) Human Mass Spec Standard

SKU
PH317163
MFGE8 MS Standard C13 and N15-labeled recombinant protein (NP_005919)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217163]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC217163 representing NM_005928
Red=Cloning site Green=Tags(s)

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC
VEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG
VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT
SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA
GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN
HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005919
RefSeq Size 1934
RefSeq ORF 1161
Synonyms BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8; MFGM; OAcGD3S; SED1; SPAG10
Locus ID 4240
UniProt ID Q08431
Cytogenetics 15q26.1
Summary This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:MFGE8 (NM_005928) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401796 MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426493 MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401796 Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1 100 ug
$436.00
LY426493 Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 2 100 ug
$436.00
TP317163 Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.