OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AGRP (NM_001138) Human Mass Spec Standard

Be the first to review this product
SKU
PH317144
AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323216 Anti-AGRP Rabbit Polyclonal Antibody
100 ul
$305.00
LY416046 Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "AGRP or NM_001138"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217144
Predicted MW 14.4 kDa
Protein Sequence
Protein Sequence
>RC217144 protein sequence
Red=Cloning site Green=Tags(s)

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL
AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129
RefSeq Size 783
RefSeq ORF 396
Synonyms AGRT; ART; ASIP2
Locus ID 181
UniProt ID O00253
Cytogenetics 16q22.1
Summary This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. provided by RefSeq, Dec 2009
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Adipocytokine signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AGRP" proteins (5)
SKU Description Size Price
LC416046 Lyophilized AGRP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420100 Lyophilized AGRP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416046 Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420100 Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP) (as WB positive control) 100 ug
$436.00
TP317144 Recombinant protein of human agouti related protein homolog (mouse) (AGRP), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products