AGRP (NM_001138) Human Mass Spec Standard

SKU PH317144

AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC217144]
• Predicted MW: 14.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC217144 protein sequence; Red=Cloning site Green=Tags(s); ; MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL; AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001129
• RefSeq Size: 783
• RefSeq ORF: 396
• Synonyms: AGRT; ART; ASIP2
• Locus ID: 181
• UniProt ID: O00253
• Cytogenetics: 16q22.1
• Summary: This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Adipocytokine signaling pathway