TIM 1 (HAVCR1) (NM_012206) Human Mass Spec Standard

SKU
PH317039
HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_036338)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217039]
Predicted MW 39.25 kDa
Protein Sequence
Protein Sequence
>RC217039 representing NM_012206
Red=Cloning site Green=Tags(s)

MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT
VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST
FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ
LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA
EDNIYIENSLYATD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036338
RefSeq Size 1841
RefSeq ORF 1092
Synonyms CD365; HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1
Locus ID 26762
UniProt ID Q96D42
Cytogenetics 5q33.3
Summary The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TIM 1 (HAVCR1) (NM_012206) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH317289 HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001092884) 10 ug
$3,255.00
LC415915 HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420451 HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415915 Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 100 ug
$436.00
LY420451 Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2 100 ug
$436.00
TP317039 Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1, 20 µg 20 ug
$737.00
TP317289 Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.