OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIM 1 (HAVCR1) (NM_012206) Human Mass Spec Standard

Be the first to review this product
SKU
PH317039
HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_036338)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306320 Rabbit Polyclonal TIM-1 Antibody
100 ug
$640.00
LY415915 Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TIM 1 or NM_012206"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217039
Predicted MW 39.25 kDa
Protein Sequence
Protein Sequence
>RC217039 representing NM_012206
Red=Cloning site Green=Tags(s)

MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT
YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT
VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST
FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ
LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA
EDNIYIENSLYATD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036338
RefSeq Size 1841
RefSeq ORF 1092
Synonyms CD365; HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1
Locus ID 26762
UniProt ID Q96D42
Cytogenetics 5q33.3
Summary The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. provided by RefSeq, Apr 2015
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIM 1" proteins (7)
SKU Description Size Price
PH317289 HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001092884) 10 ug
$3,360.00
LC415915 Lyophilized HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420451 Lyophilized HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415915 Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420451 Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317039 Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1, 20 µg 20 ug
$737.00
TP317289 Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

miR29b regulates aberrant methylation in In-Vitro diabetic nephropathy model of renal proximal tubular cells
Gondaliya, Dasare, Srivastava et al
PLoS ONE (2018) 13 (11), e0208044 DOI: 10.1371/journal.pone.0208044
AI Summary: In this study, the OriGene KIM-1 antibody was used to detect levels of the kidney injury biomarker KIM-1 by Western blot, helping to assess kidney damage in the in vitro diabetic nephropathy model.
Snippet: e by using RTA Trans Turbo kit (BioRad). Detection of specific proteins were done by using primary antibody against (DNMT3A 1:2000, Abcam), (DNMT3B 1:250, Sigma), (DNMT1 1:1000, abcam), (KIM-1 1:500, origene), (fibronectin, 1:250 Abcam) and (β-actin 1:5000, Santacruz) at 4˚C overnight. After incubation of primary antibody, membrane was washed with 0.1% TBST and then membrane was incubated with s;R...
FigureFigureFigure
WB
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products