TIM 1 (HAVCR1) (NM_012206) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217039] |
Predicted MW | 39.25 kDa |
Protein Sequence |
Protein Sequence
>RC217039 representing NM_012206
Red=Cloning site Green=Tags(s) MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA EDNIYIENSLYATD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_036338 |
RefSeq Size | 1841 |
RefSeq ORF | 1092 |
Synonyms | CD365; HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1 |
Locus ID | 26762 |
UniProt ID | Q96D42 |
Cytogenetics | 5q33.3 |
Summary | The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317289 | HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001092884) | 10 ug |
$3,255.00
|
|
LC415915 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420451 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415915 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 | 100 ug |
$436.00
|
|
LY420451 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2 | 100 ug |
$436.00
|
|
TP317039 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP317289 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.