HCK (NM_002110) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217022] |
Predicted MW | 59.6 kDa |
Protein Sequence |
Protein Sequence
>RC217022 representing NM_002110
Red=Cloning site Green=Tags(s) MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002101 |
RefSeq Size | 2168 |
RefSeq ORF | 1578 |
Synonyms | JTK9; p59Hck; p61Hck |
Locus ID | 3055 |
UniProt ID | P08631 |
Cytogenetics | 20q11.21 |
Summary | The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Multiple isoforms with different subcellular distributions are produced due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) codon. [provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC419528 | HCK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433198 | HCK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433231 | HCK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419528 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 1 | 100 ug |
$436.00
|
|
LY433198 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 3 | 100 ug |
$436.00
|
|
LY433231 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 2 | 100 ug |
$436.00
|
|
TP317022 | Recombinant protein of human hemopoietic cell kinase (HCK), 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.