HCK (NM_002110) Human Mass Spec Standard

SKU
PH317022
HCK MS Standard C13 and N15-labeled recombinant protein (NP_002101)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217022]
Predicted MW 59.6 kDa
Protein Sequence
Protein Sequence
>RC217022 representing NM_002110
Red=Cloning site Green=Tags(s)

MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT
PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE
TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI
SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT
YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG
SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM
MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002101
RefSeq Size 2168
RefSeq ORF 1578
Synonyms JTK9; p59Hck; p61Hck
Locus ID 3055
UniProt ID P08631
Cytogenetics 20q11.21
Summary The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Multiple isoforms with different subcellular distributions are produced due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) codon. [provided by RefSeq, Feb 2010]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway, Fc gamma R-mediated phagocytosis
Write Your Own Review
You're reviewing:HCK (NM_002110) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419528 HCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433198 HCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433231 HCK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419528 Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 1 100 ug
$436.00
LY433198 Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 3 100 ug
$436.00
LY433231 Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 2 100 ug
$436.00
TP317022 Recombinant protein of human hemopoietic cell kinase (HCK), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.