Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Mass Spec Standard

SKU
PH316986
ACOT9 MS Standard C13 and N15-labeled recombinant protein (NP_001032248)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216986]
Predicted MW 50.85 kDa
Protein Sequence
Protein Sequence
>RC216986 representing NM_001037171
Red=Cloning site Green=Tags(s)

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEACSSIHVNHVRDKLREIVGASTNWRDHVKAM
EERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMH
NKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATF
VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDP
KTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVD
DIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGE
SMLYLDGQRHFNSMSGPATLRKDYLVEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032248
RefSeq Size 1727
RefSeq ORF 1344
Synonyms ACATE2; CGI-16; MT-ACT48; MTACT48
Locus ID 23597
UniProt ID Q9Y305
Cytogenetics Xp22.11
Summary The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421928 ACOT9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421928 Transient overexpression lysate of acyl-CoA thioesterase 9 (ACOT9), transcript variant 1 100 ug
$665.00
TP316986 Recombinant protein of human acyl-CoA thioesterase 9 (ACOT9), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.