A1CF (NM_138933) Human Mass Spec Standard

SKU
PH316911
A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620311)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216911]
Predicted MW 64.8 kDa
Protein Sequence
Protein Sequence
>RC216911 representing NM_138933
Red=Cloning site Green=Tags(s)

MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGWDAAPPERGCEIFIGK
LPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCAS
VDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPG
RIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVH
FSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYL
GAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALAS
QNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQL
KQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620311
RefSeq Size 2223
RefSeq ORF 1782
Synonyms ACF; ACF64; ACF65; APOBEC1CF; ASP
Locus ID 29974
UniProt ID Q9NQ94
Cytogenetics 10q11.23
Summary Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:A1CF (NM_138933) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316861 A1CF MS Standard C13 and N15-labeled recombinant protein (NP_620310) 10 ug
$3,255.00
LC408475 A1CF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408476 A1CF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415195 A1CF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408475 Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 2 100 ug
$665.00
LY408476 Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 3 100 ug
$665.00
LY415195 Transient overexpression lysate of APOBEC1 complementation factor (A1CF), transcript variant 1 100 ug
$665.00
TP316861 Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 2, 20 µg 20 ug
$737.00
TP316911 Recombinant protein of human APOBEC1 complementation factor (A1CF), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.