PHETA2 (NM_001002034) Human Mass Spec Standard

SKU
PH316895
FAM109B MS Standard C13 and N15-labeled recombinant protein (NP_001002034)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216895]
Predicted MW 28.2 kDa
Protein Sequence
Protein Sequence
>RC216895 representing NM_001002034
Red=Cloning site Green=Tags(s)

MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLE
GCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQ
SLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLL
GKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002034
RefSeq Size 2396
RefSeq ORF 777
Synonyms FAM109B; IPIP27B; Ses2
Locus ID 150368
UniProt ID Q6ICB4
Cytogenetics 22q13.2
Summary Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PHETA2 (NM_001002034) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424173 FAM109B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424173 Transient overexpression lysate of family with sequence similarity 109, member B (FAM109B) 100 ug
$436.00
TP316895 Recombinant protein of human family with sequence similarity 109, member B (FAM109B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.