Annexin VI (ANXA6) (NM_004033) Human Mass Spec Standard

SKU
PH316809
ANXA6 MS Standard C13 and N15-labeled recombinant protein (NP_004024)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216809]
Predicted MW 75.1 kDa
Protein Sequence
Protein Sequence
>RC216809 representing NM_004033
Red=Cloning site Green=Tags(s)

MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL
IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER
DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH
LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS
RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR
VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS
SDTSGHFRRILISLATGHREEGGENLDQAREDAQEIADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF
IKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLN
IRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004024
RefSeq Size 2897
RefSeq ORF 2001
Synonyms annexin A6; annexin VI; annexin VI (p68); ANX6; calcium-binding protein p68; calelectrin; calphobindin II; CBP68
Locus ID 309
UniProt ID P08133
Cytogenetics 5q33.1
Summary Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:Annexin VI (ANXA6) (NM_004033) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400463 ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418290 ANXA6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400463 Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 1 100 ug
$436.00
LY418290 Transient overexpression lysate of annexin A6 (ANXA6), transcript variant 2 100 ug
$665.00
TP316809 Recombinant protein of human annexin A6 (ANXA6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720183 Recombinant protein of human annexin A6 (ANXA6), transcript variant 1 10 ug
$230.00
TP761425 Purified recombinant protein of Human annexin A6 (ANXA6), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.