Prostaglandin D Synthase (PTGDS) (NM_000954) Human Mass Spec Standard

SKU
PH316795
PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216795]
Predicted MW 20.8 kDa
Protein Sequence
Protein Sequence
>RC216795 representing NM_000954
Red=Cloning site Green=Tags(s)

MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA
PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG
EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000945
RefSeq Size 837
RefSeq ORF 570
Synonyms L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2
Locus ID 5730
UniProt ID P41222
Cytogenetics 9q34.3
Summary The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Prostaglandin D Synthase (PTGDS) (NM_000954) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400343 PTGDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400343 Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS) 100 ug
$436.00
TP316795 Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 20 µg 20 ug
$867.00
TP720757 Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.