HEY1 (NM_001040708) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC216696] |
Predicted MW | 32.9 kDa |
Protein Sequence |
Protein Sequence
>RC216696 representing NM_001040708
Red=Cloning site Green=Tags(s) MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS ELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVAR YLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGT TASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLYP NALSPSAPTQAANLGKPYRPWGTEIGAF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001035798 |
RefSeq Size | 2331 |
RefSeq ORF | 924 |
Synonyms | BHLHb31; CHF2; HERP2; HESR1; hHRT1; HRT-1; NERP2; OAF1 |
Locus ID | 23462 |
UniProt ID | Q9Y5J3 |
Cytogenetics | 8q21.13 |
Summary | This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400425 | HEY1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC415875 | HEY1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400425 | Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2 | 100 ug |
$436.00
|
|
LY415875 | Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1 | 100 ug |
$436.00
|
|
TP316696 | Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP761353 | Purified recombinant protein of Human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.