HEY1 (NM_001040708) Human Mass Spec Standard

SKU
PH316696
HEY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035798)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216696]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC216696 representing NM_001040708
Red=Cloning site Green=Tags(s)

MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS
ELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVAR
YLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGT
TASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLYP
NALSPSAPTQAANLGKPYRPWGTEIGAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035798
RefSeq Size 2331
RefSeq ORF 924
Synonyms BHLHb31; CHF2; HERP2; HESR1; hHRT1; HRT-1; NERP2; OAF1
Locus ID 23462
UniProt ID Q9Y5J3
Cytogenetics 8q21.13
Summary This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HEY1 (NM_001040708) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400425 HEY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415875 HEY1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400425 Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2 100 ug
$436.00
LY415875 Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1 100 ug
$436.00
TP316696 Recombinant protein of human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 2, 20 µg 20 ug
$737.00
TP761353 Purified recombinant protein of Human hairy/enhancer-of-split related with YRPW motif 1 (HEY1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.