Sialidase 3 (NEU3) (NM_006656) Human Mass Spec Standard

SKU
PH316537
NEU3 MS Standard C13 and N15-labeled recombinant protein (NP_006647)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216537]
Predicted MW 52.1 kDa
Protein Sequence
Protein Sequence
>RC216537 representing NM_006656
Red=Cloning site Green=Tags(s)

MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT
FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV
RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP
AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP
NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL
EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE
CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006647
RefSeq Size 2748
RefSeq ORF 1383
Synonyms SIAL3
Locus ID 10825
UniProt ID Q9UQ49
Cytogenetics 11q13.4
Summary This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq, Jul 2008]
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Write Your Own Review
You're reviewing:Sialidase 3 (NEU3) (NM_006656) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401990 NEU3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401990 Transient overexpression lysate of sialidase 3 (membrane sialidase) (NEU3) 100 ug
$665.00
TP316537 Recombinant protein of human sialidase 3 (membrane sialidase) (NEU3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.