KCNJ9 (NM_004983) Human Mass Spec Standard

SKU
PH316336
KCNJ9 MS Standard C13 and N15-labeled recombinant protein (NP_004974)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216336]
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC216336 representing NM_004983
Red=Cloning site Green=Tags(s)

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL
TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL
LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI
RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV
EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY
WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004974
RefSeq Size 3029
RefSeq ORF 1179
Synonyms GIRK3; KIR3.3
Locus ID 3765
UniProt ID Q92806
Cytogenetics 1q23.2
Summary Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
Write Your Own Review
You're reviewing:KCNJ9 (NM_004983) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417612 KCNJ9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417612 Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) 100 ug
$436.00
TP316336 Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.