GLB1 (NM_000404) Human Mass Spec Standard

SKU
PH316106
GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_000395)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216106]
Predicted MW 75.9 kDa
Protein Sequence
Protein Sequence
>RC216106 representing NM_000404
Red=Cloning site Green=Tags(s)

MPGFLVRILLLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLL
KMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLL
EKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHH
LGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQP
HSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFAL
RNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYIN
DFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPS
GIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDD
PELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000395
RefSeq Size 2409
RefSeq ORF 2030
Synonyms EBP; ELNR1; MPS4B
Locus ID 2720
UniProt ID P16278
Cytogenetics 3p22.3
Summary This gene encodes a member of the glycosyl hydrolase 35 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature lysosomal enzyme. This enzyme catalyzes the hydrolysis of a terminal beta-linked galactose residue from ganglioside substrates and other glycoconjugates. Mutations in this gene may result in GM1-gangliosidosis and Morquio B syndrome. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome
Protein Pathways Galactose metabolism, Glycosaminoglycan degradation, Glycosphingolipid biosynthesis - ganglio series, Lysosome, Metabolic pathways, Other glycan degradation, Sphingolipid metabolism
Write Your Own Review
You're reviewing:GLB1 (NM_000404) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300721 GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073279) 10 ug
$3,255.00
LC424740 GLB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424740 Transient overexpression lysate of galactosidase, beta 1 (GLB1), transcript variant 1 100 ug
$436.00
TP300721 Recombinant protein of human galactosidase, beta 1 (GLB1), transcript variant 2, 20 µg 20 ug
$737.00
TP316106 Recombinant protein of human galactosidase, beta 1 (GLB1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.