COMMD6 (NM_203495) Human Mass Spec Standard

SKU
PH316105
COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216105]
Predicted MW 9.6 kDa
Protein Sequence
Protein Sequence
>RC216105 protein sequence
Red=Cloning site Green=Tags(s)

MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQN
FYRQFKEIAAVIETV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_987091
RefSeq Size 1695
RefSeq ORF 255
Synonyms Acrg
Locus ID 170622
UniProt ID Q7Z4G1
Cytogenetics 13q22.2
Summary COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009]
Write Your Own Review
You're reviewing:COMMD6 (NM_203495) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404247 COMMD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404247 Transient overexpression lysate of COMM domain containing 6 (COMMD6), transcript variant 2 100 ug
$436.00
TP316105 Recombinant protein of human COMM domain containing 6 (COMMD6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.