OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCF4 (NM_000631) Human Mass Spec Standard

Be the first to review this product
SKU
PH316094
NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809135 NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5) 100 ul
$447.00
LY402260 Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "NCF4 or NM_000631"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216094
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s)

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR
EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000622
RefSeq Size 1386
RefSeq ORF 1017
Synonyms CGD3; NCF; P40PHOX; SH3PXD4
Locus ID 4689
UniProt ID Q15080
Cytogenetics 22q12.3
Summary The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Protein Pathways Leukocyte transendothelial migration
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NCF4" proteins (7)
SKU Description Size Price
LC402260 Lyophilized NCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424600 Lyophilized NCF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402260 Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424600 Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316094 Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, 20 µg 20 ug
$867.00
TP760264 Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP760667 Purified recombinant protein of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products