CTNNBIP1 (NM_020248) Human Mass Spec Standard

SKU PH316082

CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC216082]
• Predicted MW: 9 kDa
• Protein Sequence:
  Protein Sequence

  >RC216082 representing NM_020248; Red=Cloning site Green=Tags(s); ; MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA; FSRSETEDRRQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_064633
• RefSeq Size: 2995
• RefSeq ORF: 243
• Synonyms: ICAT
• Locus ID: 56998
• UniProt ID: Q9NSA3
• Cytogenetics: 1p36.22
• Summary: The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway