Luteinizing Hormone beta (LHB) (NM_000894) Human Mass Spec Standard

SKU PH316028

LHB MS Standard C13 and N15-labeled recombinant protein (NP_000885)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC216028]
• Predicted MW: 15.35 kDa
• Protein Sequence:
  Protein Sequence

  >RC216028 representing NM_000894; Red=Cloning site Green=Tags(s); ; MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP; PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF; L; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000885
• RefSeq Size: 523
• RefSeq ORF: 423
• Synonyms: CGB4; HH23; LSH-B; LSH-beta
• Locus ID: 3972
• UniProt ID: P01229
• Cytogenetics: 19q13.33
• Summary: This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway, Neuroactive ligand-receptor interaction