OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MINDY1 (NM_018379) Human Mass Spec Standard

Be the first to review this product
SKU
PH316010
FAM63A MS Standard C13 and N15-labeled recombinant protein (NP_060849)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335967 Rabbit Polyclonal Anti-FAM63A Antibody
100 ul
$585.00
LY413073 Transient overexpression lysate of family with sequence similarity 63, member A (FAM63A), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MINDY1 or NM_018379"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216010
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC216010 protein sequence
Red=Cloning site Green=Tags(s)

MEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEHPQDTDARDADGEAREREPADQALLPSQCGDNLESPL
PEASSAPPGPTLGTLPEVETIRACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLL
AIMNILFLQWKVKLPPQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDV
NVRFTGVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTNLVTEG
LIAEQFLETTAAQLTYHGLCELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESL
HNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPEKQLQVDQDYLIALSLQQQQPRGPLGLTDLELAQQLQ
QEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCILL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060849
RefSeq Size 2851
RefSeq ORF 1407
Synonyms FAM63A; MINDY-1
Locus ID 55793
UniProt ID Q8N5J2
Cytogenetics 1q21.3
Summary Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MINDY1" proteins (4)
SKU Description Size Price
LC413073 Lyophilized FAM63A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413073 Transient overexpression lysate of family with sequence similarity 63, member A (FAM63A), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316010 Recombinant protein of human family with sequence similarity 63, member A (FAM63A), transcript variant 1, 20 µg 20 ug
$867.00
TP328423 Purified recombinant protein of Homo sapiens family with sequence similarity 63, member A (FAM63A), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products