MINDY1 (NM_018379) Human Mass Spec Standard

SKU
PH316010
FAM63A MS Standard C13 and N15-labeled recombinant protein (NP_060849)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216010]
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC216010 protein sequence
Red=Cloning site Green=Tags(s)

MEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEHPQDTDARDADGEAREREPADQALLPSQCGDNLESPL
PEASSAPPGPTLGTLPEVETIRACSMPQELPQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLL
AIMNILFLQWKVKLPPQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDV
NVRFTGVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTNLVTEG
LIAEQFLETTAAQLTYHGLCELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESL
HNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPEKQLQVDQDYLIALSLQQQQPRGPLGLTDLELAQQLQ
QEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCILL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060849
RefSeq Size 2851
RefSeq ORF 1407
Synonyms FAM63A; MINDY-1
Locus ID 55793
UniProt ID Q8N5J2
Cytogenetics 1q21.3
Summary Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MINDY1 (NM_018379) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413073 FAM63A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413073 Transient overexpression lysate of family with sequence similarity 63, member A (FAM63A), transcript variant 1 100 ug
$436.00
TP316010 Recombinant protein of human family with sequence similarity 63, member A (FAM63A), transcript variant 1, 20 µg 20 ug
$867.00
TP328423 Purified recombinant protein of Homo sapiens family with sequence similarity 63, member A (FAM63A), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.