SLC25A33 (NM_032315) Human Mass Spec Standard

SKU
PH316002
SLC25A33 MS Standard C13 and N15-labeled recombinant protein (NP_115691)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216002]
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC216002 protein sequence
Red=Cloning site Green=Tags(s)

MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV
TPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAF
ITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESL
KKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFR
EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115691
RefSeq Size 1476
RefSeq ORF 963
Synonyms BMSC-MCP; PNC1
Locus ID 84275
UniProt ID Q9BSK2
Cytogenetics 1p36.22
Summary SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SLC25A33 (NM_032315) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410215 SLC25A33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410215 Transient overexpression lysate of solute carrier family 25, member 33 (SLC25A33) 100 ug
$436.00
TP316002 Recombinant protein of human solute carrier family 25, member 33 (SLC25A33), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.