SEC14 like protein 2 (SEC14L2) (NM_012429) Human Mass Spec Standard

SKU
PH315994
SEC14L2 MS Standard C13 and N15-labeled recombinant protein (NP_036561)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215994]
Predicted MW 46 kDa
Protein Sequence
Protein Sequence
>RC215994 representing NM_012429
Red=Cloning site Green=Tags(s)

MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDN
IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTT
KLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS
EDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEH
SVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED
GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036561
RefSeq Size 2818
RefSeq ORF 1209
Synonyms C22orf6; SPF; TAP; TAP1
Locus ID 23541
UniProt ID O76054
Cytogenetics 22q12.2
Summary This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:SEC14 like protein 2 (SEC14L2) (NM_012429) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415756 SEC14L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415756 Transient overexpression lysate of SEC14-like 2 (S. cerevisiae) (SEC14L2), transcript variant 1 100 ug
$436.00
TP315994 Recombinant protein of human SEC14-like 2 (S. cerevisiae) (SEC14L2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.