GSTA5 (NM_153699) Human Mass Spec Standard

SKU
PH315990
GSTA5 MS Standard C13 and N15-labeled recombinant protein (NP_714543)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215990]
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC215990 representing NM_153699
Red=Cloning site Green=Tags(s)

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA
ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL
KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE
KSLEEARKIFRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_714543
RefSeq Size 845
RefSeq ORF 666
Locus ID 221357
UniProt ID Q7RTV2
Cytogenetics 6p12.2
Summary The glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on different chromosomes. For additional information on GSTs, see GSTA1 (MIM 138359).[supplied by OMIM, Sep 2008]
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
Write Your Own Review
You're reviewing:GSTA5 (NM_153699) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406983 GSTA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406983 Transient overexpression lysate of glutathione S-transferase alpha 5 (GSTA5) 100 ug
$436.00
TP315990 Recombinant protein of human glutathione S-transferase alpha 5 (GSTA5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.