OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GSTA5 (NM_153699) Human Mass Spec Standard

Be the first to review this product
SKU
PH315990
GSTA5 MS Standard C13 and N15-labeled recombinant protein (NP_714543)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406983 Transient overexpression lysate of glutathione S-transferase alpha 5 (GSTA5) (as WB positive control) 100 ug
$436.00

Other products for "GSTA5 or NM_153699"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215990
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC215990 representing NM_153699
Red=Cloning site Green=Tags(s)

MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA
ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL
KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE
KSLEEARKIFRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_714543
RefSeq Size 845
RefSeq ORF 666
Locus ID 221357
UniProt ID Q7RTV2
Cytogenetics 6p12.2
Summary The glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on different chromosomes. For additional information on GSTs, see GSTA1 (MIM 138359).supplied by OMIM, Sep 2008
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GSTA5" proteins (3)
SKU Description Size Price
LC406983 Lyophilized GSTA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406983 Transient overexpression lysate of glutathione S-transferase alpha 5 (GSTA5) (as WB positive control) 100 ug
$436.00
TP315990 Recombinant protein of human glutathione S-transferase alpha 5 (GSTA5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products