GATC (NM_176818) Human Mass Spec Standard

SKU PH315964

GATC MS Standard C13 and N15-labeled recombinant protein (NP_789788)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC215964]
• Predicted MW: 15.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC215964 protein sequence; Red=Cloning site Green=Tags(s); ; MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAV; DTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_789788
• RefSeq Size: 4248
• RefSeq ORF: 410
• Synonyms: 15E1.2; COXPD42
• Locus ID: 283459
• UniProt ID: O43716
• Cytogenetics: 12q24.31
• Summary: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).[UniProtKB/Swiss-Prot Function]