CARD9 (NM_052813) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215899] |
Predicted MW | 62.1 kDa |
Protein Sequence |
Protein Sequence
>RC215899 representing NM_052813
Red=Cloning site Green=Tags(s) MSDYENDDECWNVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS TRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_434700 |
RefSeq Size | 2136 |
RefSeq ORF | 1608 |
Synonyms | CANDF2; hCARD9 |
Locus ID | 64170 |
UniProt ID | Q9H257 |
Cytogenetics | 9q34.3 |
Summary | The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH325844 | CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434701) | 10 ug |
$3,255.00
|
|
LC409473 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429892 | CARD9 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409473 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 1 | 100 ug |
$665.00
|
|
LY429892 | Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 2 | 100 ug |
$436.00
|
|
TP315899 | Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP325844 | Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.