GM CSF Receptor alpha (CSF2RA) (NM_006140) Human Mass Spec Standard

SKU
PH315857
CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_006131)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215857]
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC215857 protein sequence
Red=Cloning site Green=Tags(s)

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV
EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR
GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL
DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR
YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFL
RIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006131
RefSeq Size 1855
RefSeq ORF 1200
Synonyms alphaGMR; CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR; GMR-alpha; SMDP4
Locus ID 1438
UniProt ID P15509
Cytogenetics X;Y
Summary The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Pathways in cancer
Write Your Own Review
You're reviewing:GM CSF Receptor alpha (CSF2RA) (NM_006140) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301204 CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758448) 10 ug
$3,255.00
PH320607 CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450) 10 ug
$3,255.00
LC403538 CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406763 CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416841 CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431354 CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431905 CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403538 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 100 ug
$436.00
LY406763 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 100 ug
$436.00
LY416841 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1 100 ug
$436.00
LY431354 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 9 100 ug
$436.00
LY431905 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7 100 ug
$436.00
TP301204 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2, 20 µg 20 ug
$737.00
TP315857 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1, 20 µg 20 ug
$737.00
TP320607 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4, 20 µg 20 ug
$737.00
TP328877 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.