OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GM CSF Receptor alpha (CSF2RA) (NM_006140) Human Mass Spec Standard

Be the first to review this product
SKU
PH315857
CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_006131)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812521 CSF2RA mouse monoclonal antibody,clone OTI2B2 100 ul
$447.00
LY403538 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "GM CSF Receptor alpha or NM_006140"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215857
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC215857 protein sequence
Red=Cloning site Green=Tags(s)

MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV
EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR
GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL
DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR
YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFL
RIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006131
RefSeq Size 1855
RefSeq ORF 1200
Synonyms alphaGMR; CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR; GMR-alpha; SMDP4
Locus ID 1438
UniProt ID P15509
Cytogenetics X;Y
Summary The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GM CSF Receptor alpha" proteins (16)
SKU Description Size Price
PH301204 CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758448) 10 ug
$3,360.00
PH320607 CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450) 10 ug
$3,360.00
LC403538 Lyophilized CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406763 Lyophilized CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416841 Lyophilized CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431354 Lyophilized CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431905 Lyophilized CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403538 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY406763 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416841 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431354 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 9 (as WB positive control) 100 ug
$436.00
LY431905 Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7 (as WB positive control) 100 ug
$436.00
TP301204 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2, 20 µg 20 ug
$737.00
TP315857 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1, 20 µg 20 ug
$737.00
TP320607 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4, 20 µg 20 ug
$737.00
TP328877 Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products