QK1 (QKI) (NM_206855) Human Mass Spec Standard

SKU
PH315788
QKI MS Standard C13 and N15-labeled recombinant protein (NP_996737)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215788]
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC215788 representing NM_206855
Red=Cloning site Green=Tags(s)

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGKFFSPWG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996737
RefSeq Size 7919
RefSeq ORF 957
Synonyms Hqk; hqkI; QK; QK1; QK3
Locus ID 9444
UniProt ID Q96PU8
Cytogenetics 6q26
Summary The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:QK1 (QKI) (NM_206855) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305779 QKI MS Standard C13 and N15-labeled recombinant protein (NP_006766) 10 ug
$3,255.00
PH315734 QKI MS Standard C13 and N15-labeled recombinant protein (NP_996736) 10 ug
$3,255.00
PH324090 QKI MS Standard C13 and N15-labeled recombinant protein (NP_996735) 10 ug
$3,255.00
LC402025 QKI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403718 QKI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403730 QKI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403731 QKI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402025 Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1 100 ug
$436.00
LY403718 Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4 100 ug
$436.00
LY403730 Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2 100 ug
$436.00
LY403731 Transient overexpression lysate of quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3 100 ug
$436.00
TP305779 Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315734 Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315788 Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324090 Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.