Follistatin (FST) (NM_006350) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215777] |
Predicted MW | 34.8 kDa |
Protein Sequence |
Protein Sequence
>RC215777 representing NM_006350
Red=Cloning site Green=Tags(s) MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006341 |
RefSeq Size | 1386 |
RefSeq ORF | 951 |
Synonyms | FS |
Locus ID | 10468 |
UniProt ID | P19883 |
Cytogenetics | 5q11.2 |
Summary | Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302523 | FST MS Standard C13 and N15-labeled recombinant protein (NP_037541) | 10 ug |
$3,255.00
|
|
LC415607 | FST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416705 | FST HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415607 | Transient overexpression lysate of follistatin (FST), transcript variant FST344 | 100 ug |
$436.00
|
|
LY416705 | Transient overexpression lysate of follistatin (FST), transcript variant FST317 | 100 ug |
$436.00
|
|
TP302523 | Recombinant protein of human follistatin (FST), transcript variant FST344, 20 µg | 20 ug |
$737.00
|
|
TP315777 | Recombinant protein of human follistatin (FST), transcript variant FST317, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.