MACROD2 (NM_001033087) Human Mass Spec Standard

SKU
PH315636
MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_001028259)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215636]
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC215636 protein sequence
Red=Cloning site Green=Tags(s)

MNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDADGVNTVTVPGPASEEAVEDCKDEDFA
KDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYMETEELSSNQEDAVIVEQPEVIPLTE
DQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRN
GTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028259
RefSeq Size 4425
RefSeq ORF 639
Synonyms C2orf133; C20orf133
Locus ID 140733
UniProt ID A1Z1Q3
Cytogenetics 20p12.1
Summary The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017]
Write Your Own Review
You're reviewing:MACROD2 (NM_001033087) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322689 MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_542407) 10 ug
$3,255.00
LC409100 MACROD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409100 Transient overexpression lysate of MACRO domain containing 2 (MACROD2), transcript variant 1 100 ug
$665.00
TP315636 Recombinant protein of human MACRO domain containing 2 (MACROD2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322689 Purified recombinant protein of Homo sapiens MACRO domain containing 2 (MACROD2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.