ZnT1 (SLC30A1) (NM_021194) Human Mass Spec Standard

SKU
PH315616
SLC30A1 MS Standard C13 and N15-labeled recombinant protein (NP_067017)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215616]
Predicted MW 55.1 kDa
Protein Sequence
Protein Sequence
>RC215616 representing NM_021194
Red=Cloning site Green=Tags(s)

MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKN
TFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHHSGF
SQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPE
NPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGD
FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQ
IDIRNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPE
FASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKPRRTKAENIPA
VVIEIKNMPNKQPESSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067017
RefSeq Size 2034
RefSeq ORF 1521
Synonyms ZNT1; ZRC1
Locus ID 7779
UniProt ID Q9Y6M5
Cytogenetics 1q32.3
Summary May be involved in zinc transport out of the cell.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ZnT1 (SLC30A1) (NM_021194) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412033 SLC30A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412033 Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 1 (SLC30A1) 100 ug
$665.00
TP315616 Recombinant protein of human solute carrier family 30 (zinc transporter), member 1 (SLC30A1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.