STK23 (SRPK3) (NM_014370) Human Mass Spec Standard

SKU
PH315496
SRPK3 MS Standard C13 and N15-labeled recombinant protein (NP_055185)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215496]
Predicted MW 62 kDa
Protein Sequence
Protein Sequence
>RC215496 protein sequence
Red=Cloning site Green=Tags(s)

MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK
IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR
ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH
TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR
LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT
SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP
AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL
QHPWLNP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055185
RefSeq Size 2014
RefSeq ORF 1701
Synonyms MSSK-1; MSSK1; STK23
Locus ID 26576
UniProt ID Q9UPE1
Cytogenetics Xq28
Summary This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:STK23 (SRPK3) (NM_014370) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415334 SRPK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433283 SRPK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415334 Transient overexpression lysate of SFRS protein kinase 3 (SRPK3), transcript variant 1 100 ug
$665.00
LY433283 Transient overexpression lysate of SRSF protein kinase 3 (SRPK3), transcript variant 2 100 ug
$436.00
TP315496 Recombinant protein of human SFRS protein kinase 3 (SRPK3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.