DAPP1 (NM_014395) Human Mass Spec Standard

SKU
PH315474
DAPP1 MS Standard C13 and N15-labeled recombinant protein (NP_055210)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215474]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC215474 representing NM_014395
Red=Cloning site Green=Tags(s)

MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE
SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL
TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055210
RefSeq Size 2953
RefSeq ORF 840
Synonyms BAM32
Locus ID 27071
UniProt ID Q9UN19
Cytogenetics 4q23
Summary May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Phosphatase
Protein Pathways B cell receptor signaling pathway
Write Your Own Review
You're reviewing:DAPP1 (NM_014395) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402326 DAPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402326 Transient overexpression lysate of dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1) 100 ug
$436.00
TP315474 Recombinant protein of human dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.