LARP6 (NM_197958) Human Mass Spec Standard

SKU
PH315460
LARP6 MS Standard C13 and N15-labeled recombinant protein (NP_932062)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215460]
Predicted MW 9.6 kDa
Protein Sequence
Protein Sequence
>RC215460 representing NM_197958
Red=Cloning site Green=Tags(s)

MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHRNRS
SVNSRTMLASFIVSSAPSTAPST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_932062
RefSeq Size 577
RefSeq ORF 279
Synonyms ACHN
Locus ID 55323
UniProt ID Q9BRS8
Cytogenetics 15q23
Summary Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LARP6 (NM_197958) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405156 LARP6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405156 Transient overexpression lysate of La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2 100 ug
$436.00
TP315460 Recombinant protein of human La ribonucleoprotein domain family, member 6 (LARP6), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.