LARP6 (NM_197958) Human Mass Spec Standard

SKU PH315460

LARP6 MS Standard C13 and N15-labeled recombinant protein (NP_932062)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC215460]
• Predicted MW: 9.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC215460 representing NM_197958; Red=Cloning site Green=Tags(s); ; MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHRNRS; SVNSRTMLASFIVSSAPSTAPST; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_932062
• RefSeq Size: 577
• RefSeq ORF: 279
• Synonyms: ACHN
• Locus ID: 55323
• UniProt ID: Q9BRS8
• Cytogenetics: 15q23
• Summary: Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.[UniProtKB/Swiss-Prot Function]