ENAH (NM_018212) Human Mass Spec Standard

SKU
PH315455
ENAH MS Standard C13 and N15-labeled recombinant protein (NP_060682)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215455]
Predicted MW 63.7 kDa
Protein Sequence
Protein Sequence
>RC215455 representing NM_018212
Red=Cloning site Green=Tags(s)

MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY
NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL
EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL
ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV
LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP
PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP
EPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAI
RQELSKSNTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060682
RefSeq Size 13109
RefSeq ORF 1710
Synonyms ENA; MENA; NDPP1
Locus ID 55740
UniProt ID Q8N8S7
Cytogenetics 1q42.12
Summary This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016]
Protein Pathways Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:ENAH (NM_018212) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310677 ENAH MS Standard C13 and N15-labeled recombinant protein (NP_001008493) 10 ug
$3,255.00
LC423439 ENAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423439 Transient overexpression lysate of enabled homolog (Drosophila) (ENAH), transcript variant 1 100 ug
$436.00
TP310677 Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 1, 20 µg 20 ug
$737.00
TP315455 Recombinant protein of human enabled homolog (Drosophila) (ENAH), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.