Livin (BIRC7) (NM_022161) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215363] |
Predicted MW | 30.7 kDa |
Protein Sequence |
Protein Sequence
>RC215363 representing NM_022161
Red=Cloning site Green=Tags(s) MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS ESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_071444 |
RefSeq Size | 1268 |
RefSeq ORF | 840 |
Synonyms | KIAP; LIVIN; ML-IAP; MLIAP; RNF50 |
Locus ID | 79444 |
UniProt ID | Q96CA5 |
Cytogenetics | 20q13.33 |
Summary | This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304906 | BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_647478) | 10 ug |
$3,255.00
|
|
LC403386 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411731 | BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403386 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1 | 100 ug |
$436.00
|
|
LY411731 | Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2 | 100 ug |
$436.00
|
|
TP304906 | Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP315363 | Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.