Livin (BIRC7) (NM_022161) Human Mass Spec Standard

SKU
PH315363
BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_071444)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215363]
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC215363 representing NM_022161
Red=Cloning site Green=Tags(s)

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP
WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS
ESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071444
RefSeq Size 1268
RefSeq ORF 840
Synonyms KIAP; LIVIN; ML-IAP; MLIAP; RNF50
Locus ID 79444
UniProt ID Q96CA5
Cytogenetics 20q13.33
Summary This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Livin (BIRC7) (NM_022161) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304906 BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_647478) 10 ug
$3,255.00
LC403386 BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411731 BIRC7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403386 Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1 100 ug
$436.00
LY411731 Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2 100 ug
$436.00
TP304906 Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1, 20 µg 20 ug
$737.00
TP315363 Recombinant protein of human baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.