FECH (NM_001012515) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215223] |
Predicted MW | 48.63 kDa |
Protein Sequence |
Protein Sequence
>RC215223 representing NM_001012515
Red=Cloning site Green=Tags(s) MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRYESNI RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKI WTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLN AIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGD PYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIET LYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRET KSFFTSQQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001012533 |
RefSeq Size | 3835 |
RefSeq ORF | 1287 |
Synonyms | EPP; EPP1; FCE |
Locus ID | 2235 |
UniProt ID | P22830 |
Cytogenetics | 18q21.31 |
Summary | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308058 | FECH MS Standard C13 and N15-labeled recombinant protein (NP_000131) | 10 ug |
$3,255.00
|
|
LC400049 | FECH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422881 | FECH HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400049 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2 | 100 ug |
$436.00
|
|
LY422881 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1 | 100 ug |
$665.00
|
|
TP308058 | Recombinant protein of human ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP315223 | Purified recombinant protein of Homo sapiens ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.