SPRR2A (NM_005988) Human Mass Spec Standard

SKU
PH315197
SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215197]
Predicted MW 8 kDa
Protein Sequence
Protein Sequence
>RC215197 protein sequence
Red=Cloning site Green=Tags(s)

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK
SK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005979
RefSeq Size 692
RefSeq ORF 216
Locus ID 6700
UniProt ID P35326
Cytogenetics 1q21.3
Summary Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SPRR2A (NM_005988) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416935 SPRR2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416935 Transient overexpression lysate of small proline-rich protein 2A (SPRR2A) 100 ug
$436.00
TP315197 Recombinant protein of human small proline-rich protein 2A (SPRR2A), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.