OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPRR2A (NM_005988) Human Mass Spec Standard

Be the first to review this product
SKU
PH315197
SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808452 SPRR2A mouse monoclonal antibody, clone OTI4B3 (formerly 4B3) 100 ul
$447.00
LY416935 Transient overexpression lysate of small proline-rich protein 2A (SPRR2A) (as WB positive control) 100 ug
$436.00

Other products for "SPRR2A or NM_005988"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215197
Predicted MW 8 kDa
Protein Sequence
Protein Sequence
>RC215197 protein sequence
Red=Cloning site Green=Tags(s)

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPK
SK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005979
RefSeq Size 692
RefSeq ORF 216
Locus ID 6700
UniProt ID P35326
Cytogenetics 1q21.3
Summary Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPRR2A" proteins (3)
SKU Description Size Price
LC416935 Lyophilized SPRR2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416935 Transient overexpression lysate of small proline-rich protein 2A (SPRR2A) (as WB positive control) 100 ug
$436.00
TP315197 Recombinant protein of human small proline-rich protein 2A (SPRR2A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products