PAX3 (NM_181457) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215181] |
Predicted MW | 52.8 kDa |
Protein Sequence |
Protein Sequence
>RC215181 representing NM_181457
Red=Cloning site Green=Tags(s) MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKD AVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSE PDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGA NQLMAFNHLIPGGFPPTAMPTLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDS SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE PTTTVSASCSQRLDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSKPWTF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_852122 |
RefSeq Size | 3193 |
RefSeq ORF | 1437 |
Synonyms | CDHS; HUP2; WS1; WS3 |
Locus ID | 5077 |
UniProt ID | P23760 |
Cytogenetics | 2q36.1 |
Summary | This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405766 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC405767 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC405768 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC405770 | PAX3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405766 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3 | 100 ug |
$665.00
|
|
LY405767 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3D | 100 ug |
$665.00
|
|
LY405768 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3E | 100 ug |
$665.00
|
|
LY405770 | Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3G | 100 ug |
$436.00
|
|
TP315181 | Purified recombinant protein of Homo sapiens paired box 3 (PAX3), transcript variant PAX3, 20 µg | 20 ug |
$737.00
|
|
TP760417 | Purified recombinant protein of Human paired box 3 (PAX3), transcript variant PAX3D, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.