PAX3 (NM_181457) Human Mass Spec Standard

SKU
PH315181
PAX3 MS Standard C13 and N15-labeled recombinant protein (NP_852122)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215181]
Predicted MW 52.8 kDa
Protein Sequence
Protein Sequence
>RC215181 representing NM_181457
Red=Cloning site Green=Tags(s)

MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPC
VISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKD
AVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSE
PDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGA
NQLMAFNHLIPGGFPPTAMPTLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDS
SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE
PTTTVSASCSQRLDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSKPWTF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852122
RefSeq Size 3193
RefSeq ORF 1437
Synonyms CDHS; HUP2; WS1; WS3
Locus ID 5077
UniProt ID P23760
Cytogenetics 2q36.1
Summary This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. [provided by RefSeq, Jul 2008]
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
Write Your Own Review
You're reviewing:PAX3 (NM_181457) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405766 PAX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405767 PAX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405768 PAX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405770 PAX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405766 Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3 100 ug
$665.00
LY405767 Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3D 100 ug
$665.00
LY405768 Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3E 100 ug
$665.00
LY405770 Transient overexpression lysate of paired box 3 (PAX3), transcript variant PAX3G 100 ug
$436.00
TP315181 Purified recombinant protein of Homo sapiens paired box 3 (PAX3), transcript variant PAX3, 20 µg 20 ug
$737.00
TP760417 Purified recombinant protein of Human paired box 3 (PAX3), transcript variant PAX3D, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.